Paralogue Annotation for RYR1 residue 27

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 27
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 27

No paralogue variants have been mapped to residue 27 for RYR1.



RYR1MGD-AE-GEDEVQFLRTDDEVVLQCSAT>V<LKEQLKLCLAAEGFGNRLCFLEPTSNAQNV57
RYR2MADGGE-GEDEIQFLRTDDEVVLQCTAT>I<HKEQQKLCLAAEGFGNRLCFLESTSNSKNV58
RYR3MAEGGEGGEDEIQFLRTEDEVVLQCIAT>I<HKEQRKFCLAAEGLGNRLCFLEPTSEAKYI59
cons                            > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V27Mc.79G>A Putative BenignSIFT:
Polyphen: probably damaging