Paralogue Annotation for RYR1 residue 2712

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2712
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2712

No paralogue variants have been mapped to residue 2712 for RYR1.



RYR1IFDSLAHKKYDPELYRMAMPCLCAIAGALP>P<DYVDASYSSKAEKKATVDAEGNFDPRPVET2742
RYR2IFDALSQKKYEQELFKLALPCLSAVAGALP>P<DYMESNYVSMMEKQSSMDSEGNFNPQPVDT2708
RYR3IFDSLSHKKYDPDLFRMALPCLSAIAGALP>P<DYLDTRITATLEKQISVDADGNFDPKPINT2605
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P2712Sc.8134C>T Putative BenignSIFT: deleterious
Polyphen: benign