Paralogue Annotation for RYR1 residue 2733

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2733
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2733

No paralogue variants have been mapped to residue 2733 for RYR1.



RYR1LCAIAGALPPDYVDASYSSKAEKKATVDAE>G<NFDPRPVETLNVIIPEKLDSFINKFAEYTH2763
RYR2LSAVAGALPPDYMESNYVSMMEKQSSMDSE>G<NFNPQPVDTSNITIPEKLEYFINKYAEHSH2729
RYR3LSAIAGALPPDYLDTRITATLEKQISVDAD>G<NFDPKPINTMNFSLPEKLEYIVTKYAEHSH2626
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G2733Dc.8198G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Screening of the entire ryanodine receptor type 1 coding region for sequence variants associated with malignant hyperthermia susceptibility in the north american population. Anesthesiology. 2005 102(3):515-21. 15731587