Paralogue Annotation for RYR1 residue 2769

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2769
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2769

No paralogue variants have been mapped to residue 2769 for RYR1.



RYR1PVETLNVIIPEKLDSFINKFAEYTHEKWAF>D<KIQNNWSYGENIDEELKTHPMLRPYKTFSE2799
RYR2PVDTSNITIPEKLEYFINKYAEHSHDKWSM>D<KLANGWIYGEIYSDSSKVQPLMKPYKLLSE2765
RYR3PINTMNFSLPEKLEYIVTKYAEHSHDKWAC>D<KSQSGWKYGISLDENVKTHPLIRPFKTLTE2662
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2769Nc.8305G>A Putative BenignSIFT: deleterious
Polyphen: benign