Paralogue Annotation for RYR1 residue 2807

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2807
Reference Amino Acid: W - Tryptophan
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2807

No paralogue variants have been mapped to residue 2807 for RYR1.



RYR1YGENIDEELKTHPMLRPYKTFSEKDKEIYR>W<PIKESLKAMIAWEWTIEKAREGEEEK--TE2835
RYR2YGEIYSDSSKVQPLMKPYKLLSEKEKEIYR>W<PIKESLKTMLAWGWRIERTREGDSMALYNR2803
RYR3YGISLDENVKTHPLIRPFKTLTEKEKEIYR>W<PARESLKTMLAVGWTVERTKEGEALVQQRE2700
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.W2807Rc.8419T>C UnknownSIFT:
Polyphen: benign