Paralogue Annotation for RYR1 residue 2817

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2817
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2817

No paralogue variants have been mapped to residue 2817 for RYR1.



RYR1THPMLRPYKTFSEKDKEIYRWPIKESLKAM>I<AWEWTIEKAREGEEEK--TEKKKTRKISQS2845
RYR2VQPLMKPYKLLSEKEKEIYRWPIKESLKTM>L<AWGWRIERTREGDSMALYNRTRRISQTSQV2813
RYR3THPLIRPFKTLTEKEKEIYRWPARESLKTM>L<AVGWTVERTKEGEALVQQRENEKLRSVSQA2710
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I2817Tc.8450T>C Putative BenignSIFT: deleterious
Polyphen: benign