Paralogue Annotation for RYR1 residue 2838

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2838
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2838

No paralogue variants have been mapped to residue 2838 for RYR1.



RYR1KESLKAMIAWEWTIEKAREGEEEK--TEKK>K<TRKISQSAQTYDPREGYNPQPPDLSAVTLS2868
RYR2KESLKTMLAWGWRIERTREGDSMALYNRTR>R<ISQTSQV--SVDAAHGYSPRAIDMSNVTLS2834
RYR3RESLKTMLAVGWTVERTKEGEALVQQRENE>K<LRSVSQA--NQ--GNSYSPAPLDLSNVVLS2729
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K2838Nc.8514A>C Putative BenignSIFT:
Polyphen: benign