Paralogue Annotation for RYR1 residue 2840

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2840
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2840

No paralogue variants have been mapped to residue 2840 for RYR1.



RYR1SLKAMIAWEWTIEKAREGEEEK--TEKKKT>R<KISQSAQTYDPREGYNPQPPDLSAVTLSRE2870
RYR2SLKTMLAWGWRIERTREGDSMALYNRTRRI>S<QTSQV--SVDAAHGYSPRAIDMSNVTLSRD2836
RYR3SLKTMLAVGWTVERTKEGEALVQQRENEKL>R<SVSQA--NQ--GNSYSPAPLDLSNVVLSRE2731
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2840Wc.8518C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943