Paralogue Annotation for RYR1 residue 2856

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2856
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2856

No paralogue variants have been mapped to residue 2856 for RYR1.



RYR1EGEEEK--TEKKKTRKISQSAQTYDPREGY>N<PQPPDLSAVTLSRELQAMAEQLAENYHNTW2886
RYR2EGDSMALYNRTRRISQTSQV--SVDAAHGY>S<PRAIDMSNVTLSRDLHAMAEMMAENYHNIW2852
RYR3EGEALVQQRENEKLRSVSQA--NQ--GNSY>S<PAPLDLSNVVLSRELQGMVEVVAENYHNIW2747
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N2856Tc.8567A>C Putative BenignSIFT: tolerated
Polyphen: benign