Paralogue Annotation for RYR1 residue 2861

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2861
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2861

No paralogue variants have been mapped to residue 2861 for RYR1.



RYR1K--TEKKKTRKISQSAQTYDPREGYNPQPP>D<LSAVTLSRELQAMAEQLAENYHNTWGRKKK2891
RYR2ALYNRTRRISQTSQV--SVDAAHGYSPRAI>D<MSNVTLSRDLHAMAEMMAENYHNIWAKKKK2857
RYR3VQQRENEKLRSVSQA--NQ--GNSYSPAPL>D<LSNVVLSRELQGMVEVVAENYHNIWAKKKK2752
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2861Nc.8581G>A Putative BenignSIFT:
Polyphen: benign