Paralogue Annotation for RYR1 residue 2880

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2880
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2880

No paralogue variants have been mapped to residue 2880 for RYR1.



RYR1DPREGYNPQPPDLSAVTLSRELQAMAEQLA>E<NYHNTWGRKKKQELEAKGGGTHPLLVPYDT2910
RYR2DAAHGYSPRAIDMSNVTLSRDLHAMAEMMA>E<NYHNIWAKKKKMELESKGGGNHPLLVPYDT2876
RYR3--GNSYSPAPLDLSNVVLSRELQGMVEVVA>E<NYHNIWAKKKKLELESKGGGSHPLLVPYDT2771
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2880Kc.8638G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943