Paralogue Annotation for RYR1 residue 2918

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2918
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2918

No paralogue variants have been mapped to residue 2918 for RYR1.



RYR1RKKKQELEAKGGGTHPLLVPYDTLTAKEKA>R<DREKAQELLKFLQMNGYAVTRGLKDMELDS2948
RYR2KKKKMELESKGGGNHPLLVPYDTLTAKEKA>K<DREKAQDILKFLQINGYAVSRGFKDLELDT2914
RYR3KKKKLELESKGGGSHPLLVPYDTLTAKEKF>K<DREKAQDLFKFLQVNGIIVSRGMKDMELDA2809
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2918Gc.8752C>G Putative BenignSIFT: deleterious
Polyphen: benign