Paralogue Annotation for RYR1 residue 2939

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2939
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2939

No paralogue variants have been mapped to residue 2939 for RYR1.



RYR1DTLTAKEKARDREKAQELLKFLQMNGYAVT>R<GLKDMELDSSSIEKRFAFGFLQQLLRWMDI2969
RYR2DTLTAKEKAKDREKAQDILKFLQINGYAVS>R<GFKDLELDTPSIEKRFAYSFLQQLIRYVDE2935
RYR3DTLTAKEKFKDREKAQDLFKFLQVNGIIVS>R<GMKDMELDASSMEKRFAYKFLKKILKYVDS2830
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2939Kc.8816G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Molecular mechanisms and phenotypic variation in RYR1-related congenital myopathies. Brain. 2007 130(Pt 8):2024-36. 17483490
Unknown Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180. 22009146
Other Myopathy Multi-minicore disease and atypical periodic paralysis associated with novel mutations in the skeletal muscle ryanodine receptor (RYR1) gene. Neuromuscul Disord. 2010 20(3):166-73. doi: 10.1016/j.nmd.2009.12.005. 20080402