Paralogue Annotation for RYR1 residue 2943

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2943
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2943

No paralogue variants have been mapped to residue 2943 for RYR1.



RYR1AKEKARDREKAQELLKFLQMNGYAVTRGLK>D<MELDSSSIEKRFAFGFLQQLLRWMDISQEF2973
RYR2AKEKAKDREKAQDILKFLQINGYAVSRGFK>D<LELDTPSIEKRFAYSFLQQLIRYVDEAHQY2939
RYR3AKEKFKDREKAQDLFKFLQVNGIIVSRGMK>D<MELDASSMEKRFAYKFLKKILKYVDSAQEF2834
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2943Nc.8827G>A BenignSIFT:
Polyphen: benign