Paralogue Annotation for RYR1 residue 2987

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2987
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2987

No paralogue variants have been mapped to residue 2987 for RYR1.



RYR1FGFLQQLLRWMDISQEFIAHLEAVVSSGRV>E<KSPHEQEIKFFAKILLPLINQYFTNHCLYF3017
RYR2YSFLQQLIRYVDEAHQYILEFDGG-SRGKG>E<HFPYEQEIKFFAKVVLPLIDQYFKNHRLYF2982
RYR3YKFLKKILKYVDSAQEFIAHLEAIVSSGKT>E<KSPRDQEIKFFAKVLLPLVDQYFTSHCLYF2878
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2987Qc.8959G>C Putative BenignSIFT: tolerated
Polyphen: benign
p.E2987Gc.8960A>G Putative BenignSIFT: tolerated
Polyphen: benign