Paralogue Annotation for RYR1 residue 30

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 30
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 30

No paralogue variants have been mapped to residue 30 for RYR1.



RYR1GD-AE-GEDEVQFLRTDDEVVLQCSATVLK>E<QLKLCLAAEGFGNRLCFLEPTSNAQNVPPD60
RYR2ADGGE-GEDEIQFLRTDDEVVLQCTATIHK>E<QQKLCLAAEGFGNRLCFLESTSNSKNVPPD61
RYR3AEGGEGGEDEIQFLRTEDEVVLQCIATIHK>E<QRKFCLAAEGLGNRLCFLEPTSEAKYIPPD62
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E30Vc.89A>T Other Cardiac PhenotypeSIFT:
Polyphen: probably damaging
ReportsOther Cardiac Phenotype De Novo and Rare Variants at Multiple Loci Support the Oligogenic Origins of Atrioventricular Septal Heart Defects. PLoS Genet. 2016 12(4):e1005963. doi: 10.1371/journal.pgen.1005963. 27058611
p.E30Kc.88G>A Putative BenignSIFT:
Polyphen: