Paralogue Annotation for RYR1 residue 3066

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3066
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3066

No paralogue variants have been mapped to residue 3066 for RYR1.



RYR1KEMITSLFCKLAALVRHRVSLFGTDAPAVV>N<CLHILARSLDARTVMKSGPEIVKAGLRSFF3096
RYR2KEMVTSLFCKLGVLVRHRISLFGNDATSIV>N<CLHILGQTLDARTVMKTGLESVKSALRAFL3061
RYR3KEMVAGLFCKLAALVRHRISLFGSDSTTMV>S<CLHILAQTLDTRTVMKSGSELVKAGLRAFF2957
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N3066Kc.9198C>G Putative BenignSIFT:
Polyphen: benign