Paralogue Annotation for RYR1 residue 3100

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3100
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3100

No paralogue variants have been mapped to residue 3100 for RYR1.



RYR1ILARSLDARTVMKSGPEIVKAGLRSFFESA>S<EDIEKMVENLRLGKVSQARTQVKGVGQNLT3130
RYR2ILGQTLDARTVMKTGLESVKSALRAFLDNA>A<EDLEKTMENLKQGQFTHTRNQPKGVTQIIN3095
RYR3ILAQTLDTRTVMKSGSELVKAGLRAFFENA>A<EDLEKTSENLKLGKFTHSRTQIKGVSQNIN2991
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S3100Lc.9299C>T Putative BenignSIFT:
Polyphen: benign