Paralogue Annotation for RYR1 residue 3217

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3217
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3217

No paralogue variants have been mapped to residue 3217 for RYR1.



RYR1RPALGECLARLAAAMPVAFLEPQLNEYNAC>S<VYTTKSPRERAILGLPNSVEEMCPDIPVLE3247
RYR2RSALGECLAAFAGAFPVAFLETHLDKHNIY>S<IYNTKSSRERAALSLPTNVEDVCPNIPSLE3212
RYR3RPALGECLASLAAAIPVAFLEPTLNRYNPL>S<VFNTKTPRERSILGMPDTVEDMCPDIPQLE3108
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S3217Pc.9649T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Increasing the number of diagnostic mutations in malignant hyperthermia. Hum Mutat. 2009 30(4):590-8. 19191329