Paralogue Annotation for RYR1 residue 3220

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3220
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3220

No paralogue variants have been mapped to residue 3220 for RYR1.



RYR1LGECLARLAAAMPVAFLEPQLNEYNACSVY>T<TKSPRERAILGLPNSVEEMCPDIPVLERLM3250
RYR2LGECLAAFAGAFPVAFLETHLDKHNIYSIY>N<TKSSRERAALSLPTNVEDVCPNIPSLEKLM3215
RYR3LGECLASLAAAIPVAFLEPTLNRYNPLSVF>N<TKTPRERSILGMPDTVEDMCPDIPQLEGLM3111
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T3220Ac.9658A>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Expanding genotype/phenotype of neuromuscular diseases by comprehensive target capture/NGS. Neurol Genet. 2015 1(2):e14. doi: 10.1212/NXG.0000000000000015. eColl 27066551