Paralogue Annotation for RYR1 residue 3292

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3292
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3292

No paralogue variants have been mapped to residue 3292 for RYR1.



RYR1RYTEMPHVIEITLPMLCSYLPRWWERGPEA>P<PSALPAGAPPPCTAVTSDHLNSLLGNILRI3322
RYR2RYTQMPHVMEVILPMLCSYMSRWWEHGPEN>N<PE----RAEMCCTALNSEHMNTLLGNILKI3283
RYR3RYTEMPHVIEVILPMLCNYLSYWWERGPEN>L<PP----STGPCCTKVTSEHLSLILGNILKI3179
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P3292Sc.9874C>T Putative BenignSIFT:
Polyphen: benign