Paralogue Annotation for RYR1 residue 3298

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3298
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3298

No paralogue variants have been mapped to residue 3298 for RYR1.



RYR1HVIEITLPMLCSYLPRWWERGPEAPPSALP>A<GAPPPCTAVTSDHLNSLLGNILRIIVNNLG3328
RYR2HVMEVILPMLCSYMSRWWEHGPENNPE--->-<RAEMCCTALNSEHMNTLLGNILKIIYNNLG3289
RYR3HVIEVILPMLCNYLSYWWERGPENLPP--->-<STGPCCTKVTSEHLSLILGNILKIINNNLG3185
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3298Tc.9892G>A Putative BenignSIFT: tolerated
Polyphen: benign