Paralogue Annotation for RYR1 residue 3337

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3337
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3337

No paralogue variants have been mapped to residue 3337 for RYR1.



RYR1VTSDHLNSLLGNILRIIVNNLGIDEASWMK>R<LAVFAQPIVSRARPELLQSHFIPTIGRLRK3367
RYR2LNSEHMNTLLGNILKIIYNNLGIDEGAWMK>R<LAVFSQPIINKVKPQLLKTHFLPLMEKLKK3328
RYR3VTSEHLSLILGNILKIINNNLGIDEASWMK>R<IAVYAQPIISKARPDLLRSHFIPTLEKLKK3224
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3337Wc.10009C>T Putative BenignSIFT:
Polyphen: benign
p.R3337Gc.10009C>G Putative BenignSIFT:
Polyphen: benign