Paralogue Annotation for RYR1 residue 3348

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3348
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3348

No paralogue variants have been mapped to residue 3348 for RYR1.



RYR1NILRIIVNNLGIDEASWMKRLAVFAQPIVS>R<ARPELLQSHFIPTIGRLRKRAGKVVSEEEQ3378
RYR2NILKIIYNNLGIDEGAWMKRLAVFSQPIIN>K<VKPQLLKTHFLPLMEKLKKKAATVVSEEDH3339
RYR3NILKIINNNLGIDEASWMKRIAVYAQPIIS>K<ARPDLLRSHFIPTLEKLKKKAVKTVQEEEQ3235
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3348Hc.10043G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Screening of the entire ryanodine receptor type 1 coding region for sequence variants associated with malignant hyperthermia susceptibility in the north american population. Anesthesiology. 2005 102(3):515-21. 15731587
Other Myopathy Analysis of the entire ryanodine receptor type 1 and alpha 1 subunit of the dihydropyridine receptor (CACNA1S) coding regions for variants associated with malignant hyperthermia in Australian families. Anaesth Intensive Care. 2015 43(2):157-66. 25735680
p.R3348Cc.10042C>T Putative BenignSIFT:
Polyphen: benign
p.R3348Gc.10042C>G Other MyopathySIFT:
Polyphen: benign
ReportsOther Myopathy Novel double and single ryanodine receptor 1 variants in two Austrian malignant hyperthermia families. Anesth Analg. 2012 114(5):1017-25. doi: 10.1213/ANE.0b013e31824a95ad. 22415532