Paralogue Annotation for RYR1 residue 3407

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3407
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3407

No paralogue variants have been mapped to residue 3407 for RYR1.



RYR1EQLRLEAKAEAQEGELLVRDEFSVLCRDLY>A<LYPLLIRYVDNNRAQWLTEPNPSAEELFRM3437
RYR2DHLKAEARGDMSEAELLILDEFTTLARDLY>A<FYPLLIRFVDYNRAKWLKEPNPEAEELFRM3398
RYR3EQLKADGKGDTQEAELLILDEFAVLCRDLY>A<FYPMLIRYVDNNRSNWLKSPDADSDQLFRM3294
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3407Tc.10219G>A Other Disease PhenotypeSIFT:
Polyphen: benign
ReportsOther Disease Phenotype RYR1-related myopathies: a wide spectrum of phenotypes throughout life. Eur J Neurol. 2015 22(7):1094-112. doi: 10.1111/ene.12713. 25960145
p.A3407Sc.10219G>T Other Disease PhenotypeSIFT:
Polyphen:
ReportsOther Disease Phenotype Fever-induced recurrent rhabdomyolysis due to a novel mutation in the ryanodine receptor type 1 gene. Intern Med J. 2014 44(8):819-20. doi: 10.1111/imj.12498. 25081049