Paralogue Annotation for RYR1 residue 3426

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3426
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3426

No paralogue variants have been mapped to residue 3426 for RYR1.



RYR1DEFSVLCRDLYALYPLLIRYVDNNRAQWLT>E<PNPSAEELFRMVGEIFIYWSKSHNFKREEQ3456
RYR2DEFTTLARDLYAFYPLLIRFVDYNRAKWLK>E<PNPEAEELFRMVAEVFIYWSKSHNFKREEQ3417
RYR3DEFAVLCRDLYAFYPMLIRYVDNNRSNWLK>S<PDADSDQLFRMVAEVFILWCKSHNFKREEQ3313
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E3426Dc.10278G>C Putative BenignSIFT: tolerated
Polyphen: benign