Paralogue Annotation for RYR1 residue 3436

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3436
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3436

No paralogue variants have been mapped to residue 3436 for RYR1.



RYR1YALYPLLIRYVDNNRAQWLTEPNPSAEELF>R<MVGEIFIYWSKSHNFKREEQNFVVQNEINN3466
RYR2YAFYPLLIRFVDYNRAKWLKEPNPEAEELF>R<MVAEVFIYWSKSHNFKREEQNFVVQNEINN3427
RYR3YAFYPMLIRYVDNNRSNWLKSPDADSDQLF>R<MVAEVFILWCKSHNFKREEQNFVIQNEINN3323
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3436Kc.10307G>A Putative BenignSIFT: tolerated
Polyphen: benign