Paralogue Annotation for RYR1 residue 3487

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3487
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3487

No paralogue variants have been mapped to residue 3487 for RYR1.



RYR1NFVVQNEINNMSFLTADNKSKMAKAGDIQS>G<GSDQERTKKKRRGDRYSVQTSLIVATLKKM3517
RYR2NFVVQNEINNMSFLITDTKSKMSKAA---->-<VSDQERKKMKRKGDRYSMQTSLIVAALKRL3473
RYR3NFVIQNEINNLAFLTGDSKSKMSKAMQVKS>G<GQDQERKKTKRRGDLYSIQTSLIVAALKKM3374
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G3487Sc.10459G>A Putative BenignSIFT: tolerated
Polyphen: benign