Paralogue Annotation for RYR1 residue 3501

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3501
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3501

No paralogue variants have been mapped to residue 3501 for RYR1.



RYR1TADNKSKMAKAGDIQSGGSDQERTKKKRRG>D<RYSVQTSLIVATLKKMLPIGLNMCAPTDQD3531
RYR2ITDTKSKMSKAA-----VSDQERKKMKRKG>D<RYSMQTSLIVAALKRLLPIGLNICAPGDQE3487
RYR3TGDSKSKMSKAMQVKSGGQDQERKKTKRRG>D<LYSIQTSLIVAALKKMLPIGLNMCTPGDQE3388
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D3501Yc.10501G>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Novel missense mutations and unexpected multiple changes of RYR1 gene in 75 malignant hyperthermia families. Clin Genet. 2011 79(5):438-47. doi: 10.1111/j.1399-0004.2010.01493. 20681998