Paralogue Annotation for RYR1 residue 3526

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3526
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3526

No paralogue variants have been mapped to residue 3526 for RYR1.



RYR1KKRRGDRYSVQTSLIVATLKKMLPIGLNMC>A<PTDQDLITLAKTRYALKDTDEEVREFLHNN3556
RYR2MKRKGDRYSMQTSLIVAALKRLLPIGLNIC>A<PGDQELIALAKNRFSLKDTEDEVRDIIRSN3512
RYR3TKRRGDLYSIQTSLIVAALKKMLPIGLNMC>T<PGDQELISLAKSRYSHRDTDEEVREHLRNN3413
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3526Vc.10577C>T Putative BenignSIFT: tolerated
Polyphen: benign