Paralogue Annotation for RYR1 residue 3528

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3528
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3528

No paralogue variants have been mapped to residue 3528 for RYR1.



RYR1RRGDRYSVQTSLIVATLKKMLPIGLNMCAP>T<DQDLITLAKTRYALKDTDEEVREFLHNNLH3558
RYR2RKGDRYSMQTSLIVAALKRLLPIGLNICAP>G<DQELIALAKNRFSLKDTEDEVRDIIRSNIH3514
RYR3RRGDLYSIQTSLIVAALKKMLPIGLNMCTP>G<DQELISLAKSRYSHRDTDEEVREHLRNNLH3415
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T3528Ac.10582A>G Putative BenignSIFT: tolerated
Polyphen: benign