Paralogue Annotation for RYR1 residue 3577

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3577
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3577

No paralogue variants have been mapped to residue 3577 for RYR1.



RYR1EEVREFLHNNLHLQGKVEGSPSLRWQMALY>R<GVPGREEDADDPEKIVRRV-----------3596
RYR2DEVRDIIRSNIHLQGKLE-DPAIRWQMALY>K<DLPNRTDDTSDPEKTVERVLDIANVLFHLE3562
RYR3EEVREHLRNNLHLQEKSD-DPAVKWQLNLY>K<DVLK-SEEPFNPEKTVERV-----------3451
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3577Qc.10730G>A Putative BenignSIFT: tolerated
Polyphen: benign
p.R3577Wc.10729C>T Putative BenignSIFT: tolerated
Polyphen: benign