Paralogue Annotation for RYR1 residue 3597

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3597
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3597

No paralogue variants have been mapped to residue 3597 for RYR1.



RYR1PGREEDADDPEKIVRRV------------->Q<EVSAVLYYLDQTEHPYKSKKAVWHKLLSKQ3627
RYR2PNRTDDTSDPEKTVERVLDIANVLFHLEQK>S<KRVGRRHYCL-VEHPQRSKKAVWHKLLSKQ3594
RYR3LK-SEEPFNPEKTVERV------------->Q<RISAAVFHLEQVEQPLRSKKAVWHKLLSKQ3482
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q3597Kc.10789C>A Putative BenignSIFT:
Polyphen: benign