Paralogue Annotation for RYR1 residue 3602

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3602
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3602

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2R3570WSudden cardiac deathMedium6 19781797, 24025405, 25525159

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1DADDPEKIVRRV-------------QEVSA>V<LYYLDQTEHPYKSKKAVWHKLLSKQRRRAV3632
RYR2DTSDPEKTVERVLDIANVLFHLEQKSKRVG>R<RHYCL-VEHPQRSKKAVWHKLLSKQRKRAV3599
RYR3EPFNPEKTVERV-------------QRISA>A<VFHLEQVEQPLRSKKAVWHKLLSKQRKRAV3487
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 3602 for RYR1.