Paralogue Annotation for RYR1 residue 3636

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3636
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3636

No paralogue variants have been mapped to residue 3636 for RYR1.



RYR1LDQTEHPYKSKKAVWHKLLSKQRRRAVVAC>F<RMTPLYNLPTHRACNMFLESYKAAWILTED3666
RYR2CL-VEHPQRSKKAVWHKLLSKQRKRAVVAC>F<RMAPLYNLPRHRAVNLFLQGYEKSWIETEE3633
RYR3LEQVEQPLRSKKAVWHKLLSKQRKRAVVAC>F<RMAPLYNLPRHRSINLFLHGYQRFWIETEE3521
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F3636Lc.10908C>G Putative BenignSIFT: tolerated
Polyphen: benign