Paralogue Annotation for RYR1 residue 3639

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3639
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3639

No paralogue variants have been mapped to residue 3639 for RYR1.



RYR1TEHPYKSKKAVWHKLLSKQRRRAVVACFRM>T<PLYNLPTHRACNMFLESYKAAWILTEDHSF3669
RYR2VEHPQRSKKAVWHKLLSKQRKRAVVACFRM>A<PLYNLPRHRAVNLFLQGYEKSWIETEEHYF3636
RYR3VEQPLRSKKAVWHKLLSKQRKRAVVACFRM>A<PLYNLPRHRSINLFLHGYQRFWIETEEYSF3524
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T3639Mc.10916C>T Putative BenignSIFT: deleterious
Polyphen: benign