Paralogue Annotation for RYR1 residue 3647

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3647
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3647

No paralogue variants have been mapped to residue 3647 for RYR1.



RYR1KAVWHKLLSKQRRRAVVACFRMTPLYNLPT>H<RACNMFLESYKAAWILTEDHSFEDRMIDDL3677
RYR2KAVWHKLLSKQRKRAVVACFRMAPLYNLPR>H<RAVNLFLQGYEKSWIETEEHYFEDKLIEDL3644
RYR3KAVWHKLLSKQRKRAVVACFRMAPLYNLPR>H<RSINLFLHGYQRFWIETEEYSFEEKLVQDL3532
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H3647Qc.10941C>G BenignSIFT:
Polyphen: benign