Paralogue Annotation for RYR1 residue 3659

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3659
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3659

No paralogue variants have been mapped to residue 3659 for RYR1.



RYR1RRAVVACFRMTPLYNLPTHRACNMFLESYK>A<AWILTEDHSFEDRMIDDLSKAGEQEEEEEE3689
RYR2KRAVVACFRMAPLYNLPRHRAVNLFLQGYE>K<SWIETEEHYFEDKLIEDLAKPG-AEPPEED3655
RYR3KRAVVACFRMAPLYNLPRHRSINLFLHGYQ>R<FWIETEEYSFEEKLVQDLAKSPKVEEEEEE3544
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3659Pc.10975G>C Putative BenignSIFT:
Polyphen: benign