Paralogue Annotation for RYR1 residue 3709

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3709
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3709

No paralogue variants have been mapped to residue 3709 for RYR1.



RYR1KAGEQEEEEEEVEEKKPDPLHQLVLHFSRT>A<LTEKSKLDEDYLYMAYADIMAKSCHLEEGG3739
RYR2KPG-AEPPEEDEGTKRVDPLHQLILLFSRT>A<LTEKCKLEEDFLYMAYADIMAKSCHDEED-3704
RYR3KSPKVEEEEEEETEKQPDPLHQIILYFSRN>A<LTERSKLEDDPLYTSYSSMMAKSCQSGED-3593
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3709Vc.11126C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Screening of the ryanodine 1 gene for malignant hyperthermia causative mutations by high resolution melt curve analysis. Anesth Analg. 2011 113(5):1120-8. 21965348