Paralogue Annotation for RYR1 residue 3722

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3722
Reference Amino Acid: Y - Tyrosine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3722

No paralogue variants have been mapped to residue 3722 for RYR1.



RYR1EKKPDPLHQLVLHFSRTALTEKSKLDEDYL>Y<MAYADIMAKSCHLEEGGENGEAEEEVEVSF3752
RYR2TKRVDPLHQLILLFSRTALTEKCKLEEDFL>Y<MAYADIMAKSCHDEED-D--DGEEE-VKSF3714
RYR3EKQPDPLHQIILYFSRNALTERSKLEDDPL>Y<TSYSSMMAKSCQSGED-E--EEDEDKEKTF3604
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y3722Hc.11164T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Expanding genotype/phenotype of neuromuscular diseases by comprehensive target capture/NGS. Neurol Genet. 2015 1(2):e14. doi: 10.1212/NXG.0000000000000015. eColl 27066551