Paralogue Annotation for RYR1 residue 3806

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3806
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3806

No paralogue variants have been mapped to residue 3806 for RYR1.



RYR1EMVLQMISACKGETGAMVSSTLKLGISILN>G<GNAEVQQKMLDYLKDKKEVGFFQSIQALMQ3836
RYR2EMVLQTISASKGETGPMVAATLKLGIAILN>G<GNSTVQQKMLDYLKEKKDVGFFQSLAGLMQ3798
RYR3EMVLQMISASKGEMSPMVVETLKLGIAILN>G<GNAGVQQKMLDYLKEKKDAGFFQSLSGLMQ3688
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G3806Rc.11416G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Increasing the number of diagnostic mutations in malignant hyperthermia. Hum Mutat. 2009 30(4):590-8. 19191329