Paralogue Annotation for RYR1 residue 3843

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3843
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3843

No paralogue variants have been mapped to residue 3843 for RYR1.



RYR1QKMLDYLKDKKEVGFFQSIQALMQTCSVLD>L<NAFERQNKAEGLGMVNEDGTVINRQNGEKV3873
RYR2QKMLDYLKEKKDVGFFQSLAGLMQSCSVLD>L<NAFERQNKAEGLGMVTEEGS------GEKV3829
RYR3QKMLDYLKEKKDAGFFQSLSGLMQSCSVLD>L<NAFERQNKAEGLGMVTEEGTLIVRERGEKV3725
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L3843Pc.11528T>C Putative BenignSIFT:
Polyphen: benign