Paralogue Annotation for RYR1 residue 3860

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3860
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3860

No paralogue variants have been mapped to residue 3860 for RYR1.



RYR1SIQALMQTCSVLDLNAFERQNKAEGLGMVN>E<DGTVINRQNGEKVMADDEFTQDLFRFLQLL3890
RYR2SLAGLMQSCSVLDLNAFERQNKAEGLGMVT>E<EGS------GEKVLQDDEFTCDLFRFLQLL3846
RYR3SLSGLMQSCSVLDLNAFERQNKAEGLGMVT>E<EGTLIVRERGEKVLQNDEFTRDLFRFLQLL3742
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E3860Kc.11578G>A Putative BenignSIFT:
Polyphen: benign