Paralogue Annotation for RYR1 residue 3895

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3895
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3895

No paralogue variants have been mapped to residue 3895 for RYR1.



RYR1INRQNGEKVMADDEFTQDLFRFLQLLCEGH>N<NDFQNYLRTQTGNTTTINIIICTVDYLLRL3925
RYR2-----GEKVLQDDEFTCDLFRFLQLLCEGH>N<SDFQNYLRTQTGNNTTVNIIISTVDYLLRV3881
RYR3IVRERGEKVLQNDEFTRDLFRFLQLLCEGH>N<SDFQNFLRTQMGNTTTVNVIISTVDYLLRL3777
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N3895Dc.11683A>G Putative BenignSIFT: deleterious
Polyphen: benign