Paralogue Annotation for RYR1 residue 3969

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3969
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3969

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2Q3925ECatecholaminergic polymorphic ventricular tachycarHigh9 19926015, 24025405, 27114410

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1KDVIEEQGKRNFSKAMSVAKQVFNSLTEYI>Q<GPCTGNQQSLAHSRLWDAVVGFLHVFAHMM3999
RYR2KDVIDEQGQRNFSKAIQVAKQVFNTLTEYI>Q<GPCTGNQQSLAHSRLWDAVVGFLHVFAHMQ3955
RYR3KDIIDESGQHNFSKALAVTKQIFNSLTEYI>Q<GPCIGNQQSLAHSRLWDAVVGFLHVFANMQ3851
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q3969Kc.11905C>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy RYR1-related myopathies: a wide spectrum of phenotypes throughout life. Eur J Neurol. 2015 22(7):1094-112. doi: 10.1111/ene.12713. 25960145