Paralogue Annotation for RYR1 residue 3982

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3982
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3982

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2S3938RVentricular tachycardia, polymorphicHigh9 16818210, 24025405, 25525159

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1KAMSVAKQVFNSLTEYIQGPCTGNQQSLAH>S<RLWDAVVGFLHVFAHMMMKLAQDSSQIELL4012
RYR2KAIQVAKQVFNTLTEYIQGPCTGNQQSLAH>S<RLWDAVVGFLHVFAHMQMKLSQDSSQIELL3968
RYR3KALAVTKQIFNSLTEYIQGPCIGNQQSLAH>S<RLWDAVVGFLHVFANMQMKLSQDSSQIELL3864
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 3982 for RYR1.