Paralogue Annotation for RYR1 residue 3987

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3987
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3987

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2A3943TSudden unexplained deathHigh9 24631775

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1AKQVFNSLTEYIQGPCTGNQQSLAHSRLWD>A<VVGFLHVFAHMMMKLAQDSSQIELLKELLD4017
RYR2AKQVFNTLTEYIQGPCTGNQQSLAHSRLWD>A<VVGFLHVFAHMQMKLSQDSSQIELLKELMD3973
RYR3TKQIFNSLTEYIQGPCIGNQQSLAHSRLWD>A<VVGFLHVFANMQMKLSQDSSQIELLKELLD3869
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 3987 for RYR1.