Paralogue Annotation for RYR1 residue 4050

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4050
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4050

No paralogue variants have been mapped to residue 4050 for RYR1.



RYR1KDMVVMLLSLLEGNVVNGMIARQMVDMLVE>S<SSNVEMILKFFDMFLKLKDIVGSEAFQDYV4080
RYR2KDMVVMLLSMLEGNVVNGTIGKQMVDMLVE>S<SNNVEMILKFFDMFLKLKDLTSSDTFKEYD4036
RYR3QDMVVMLLSLLEGNVVNGTIGKQMVDTLVE>S<STNVEMILKFFDMFLKLKDLTSSDTFKEYD3932
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S4050Yc.12149C>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943