Paralogue Annotation for RYR1 residue 4112

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4112
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4112

No paralogue variants have been mapped to residue 4112 for RYR1.



RYR1DPRGLISKKDFQKAMDSQKQFSGPEIQFLL>S<CSEADENEMINCEEFANRFQEPARDIGFNV4142
RYR2DGKGVISKRDFHKAMESHKHYTQSETEFLL>S<CAETDENETLDYEEFVKRFHEPAKDIGFNV4098
RYR3DGKGIISKKEFQKAMEGQKQYTQSEIDFLL>S<CAEADENDMFNYVDFVDRFHEPAKDIGFNV3994
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S4112Lc.12335C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Centronuclear myopathy due to a de novo dominant mutation in the skeletal muscle ryanodine receptor (RYR1) gene. Neuromuscul Disord. 2007 17(4):338-45. 17376685