Paralogue Annotation for RYR1 residue 4165

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4165
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4165

No paralogue variants have been mapped to residue 4165 for RYR1.



RYR1ARDIGFNVAVLLTNLSEHVPHDPRLHNFLE>L<AESILEYFRPYLGRIEIMGASRRIERIYFE4195
RYR2AKDIGFNVAVLLTNLSEHMPNDTRLQTFLE>L<AESVLNYFQPFLGRIEIMGSAKRIERVYFE4151
RYR3AKDIGFNVAVLLTNLSEHMPNDSRLKCLLD>P<AESVLNYFEPYLGRIEIMGGAKKIERVYFE4047
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L4165Mc.12493C>A Putative BenignSIFT: tolerated
Polyphen: benign